PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G51860.1
Common NameAGL72, MJM18.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 211aa    MW: 24633.8 Da    PI: 10.1776
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G51860.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.38.5e-28959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 k+ien + rqvtfskRr g++KKA+ELSvLCda+va +ifs++g+lye++s
  AT5G51860.1  9 KKIENVTSRQVTFSKRRSGLFKKAHELSVLCDAQVAAMIFSQKGRLYEFAS 59
                 68***********************************************86 PP

2K-box59.51.4e-20851701196
        K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                  e+  + l++e+  + k+ie L+  +R+++G++L+s+s+keL ++ +q+eksl  +R +K +l+ +++++l+ ke+el++e  +L+ 
  AT5G51860.1  85 EQYVQGLKKEMVTMVKKIEVLEVHNRKMMGQSLDSCSVKELSEIATQIEKSLHMVRLRKAKLYEDELQKLKAKERELKDERVRLSL 170
                  56678999**************999*******************************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.357161IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-39160IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-29323IPR002100Transcription factor, MADS-box
CDDcd002659.18E-39373No hitNo description
SuperFamilySSF554559.68E-31387IPR002100Transcription factor, MADS-box
PfamPF003193.6E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-293859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.88388187IPR002487Transcription factor, K-box
PfamPF014861.3E-1989170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009909Biological Processregulation of flower development
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0005660anatomyhydathode
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009047anatomystem
PO:0009049anatomyinflorescence
PO:0009052anatomyflower pedicel
PO:0009072anatomyplant ovary
PO:0020121anatomylateral root
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0004507developmental stageplant embryo bilateral stage
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MVRGKIEIKK IENVTSRQVT FSKRRSGLFK KAHELSVLCD AQVAAMIFSQ KGRLYEFASS  60
DIRNTIKRYA EYKREYFVAE THPIEQYVQG LKKEMVTMVK KIEVLEVHNR KMMGQSLDSC  120
SVKELSEIAT QIEKSLHMVR LRKAKLYEDE LQKLKAKERE LKDERVRLSL KKTIYTHLCQ  180
VGERPMGMPS GSKEKEDVET DLFIGFLKNR P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-19172172Myocyte-specific enhancer factor 2B
1tqe_Q7e-19172172Myocyte-specific enhancer factor 2B
1tqe_R7e-19172172Myocyte-specific enhancer factor 2B
1tqe_S7e-19172172Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible248373_at0.0
Expression AtlasAT5G51860-
AtGenExpressAT5G51860-
ATTED-IIAT5G51860-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}.
Functional Description ? help Back to Top
Source Description
UniProtMADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}.
Function -- GeneRIF ? help Back to Top
  1. AGAMOUS-LIKE 72 plays role in the floral transition in the apical and axillary meristems.
    [PMID: 21609362]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G51860.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G48150
IntActSearch Q9FLH5
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions. {ECO:0000269|PubMed:21609362}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G51860
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1412210.0AY141221.1 Arabidopsis thaliana MADS-box protein AGL72 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199999.11e-154MADS-box transcription factor AGL72
SwissprotQ9FLH51e-156AGL72_ARATH; MADS-box protein AGL72
TrEMBLD7MRJ71e-128D7MRJ7_ARALL; MADS-box protein
STRINGAT5G51860.11e-153(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  3. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  4. De Bodt S,Raes J,Van de Peer Y,Theissen G
    And then there were many: MADS goes genomic.
    Trends Plant Sci., 2003. 8(10): p. 475-83
    [PMID:14557044]
  5. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  6. Helliwell CA,Wood CC,Robertson M,James Peacock W,Dennis ES
    The Arabidopsis FLC protein interacts directly in vivo with SOC1 and FT chromatin and is part of a high-molecular-weight protein complex.
    Plant J., 2006. 46(2): p. 183-92
    [PMID:16623882]
  7. Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
    Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    Plant Biotechnol. J., 2006. 4(3): p. 317-24
    [PMID:17147637]
  8. Dorca-Fornell C, et al.
    The Arabidopsis SOC1-like genes AGL42, AGL71 and AGL72 promote flowering in the shoot apical and axillary meristems.
    Plant J., 2011. 67(6): p. 1006-17
    [PMID:21609362]
  9. Severing EI, et al.
    Predicting the impact of alternative splicing on plant MADS domain protein function.
    PLoS ONE, 2012. 7(1): p. e30524
    [PMID:22295091]